PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008237270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 303aa    MW: 35144.2 Da    PI: 6.7206
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008237270.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-5451331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eelv +yLk+k+++ +++l +vi ++d+yk+ePwd+++     ++e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+v
  XP_008237270.1   5 VPPGFRFHPTEEELVGYYLKRKINSLQIDL-DVIIDIDLYKIEPWDIQArckLGYSEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAV 98 
                     69****************************.99**************953432334778************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ls k++ +g++ktLvfykgrap+g+ktdW+mheyrl
  XP_008237270.1  99 LS-KNNIIGMRKTLVFYKGRAPNGNKTDWIMHEYRL 133
                     **.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-603154IPR003441NAC domain
PROSITE profilePS5100558.1265154IPR003441NAC domain
PfamPF023659.0E-296133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEEELVG YYLKRKINSL QIDLDVIIDI DLYKIEPWDI QARCKLGYSE  60
QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAVLS KNNIIGMRKT LVFYKGRAPN  120
GNKTDWIMHE YRLQTSEHAP PQEEGWVVCR AFKKPSPSHR QGFEALKHAY YIREHNSHAS  180
SSNFGSEMHM VNPSLGFQYQ SFGLDQQDHL ISNHIFMGNQ LTELPQLESP SISTSLANKQ  240
GVHEQQNNNI TTEHYDDQRS NMNSSDQHMD WRNLDSLLEV PLIPQNYEQE AQNHHLLGCF  300
PDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D6e-49516020174NAC domain-containing protein 19
3swp_C6e-49516020174NAC domain-containing protein 19
3swp_B6e-49516020174NAC domain-containing protein 19
3swp_A6e-49516020174NAC domain-containing protein 19
3swm_D6e-49516020174NAC domain-containing protein 19
3swm_C6e-49516020174NAC domain-containing protein 19
3swm_B6e-49516020174NAC domain-containing protein 19
3swm_A6e-49516020174NAC domain-containing protein 19
4dul_B6e-49516017171NAC domain-containing protein 19
4dul_A6e-49516017171NAC domain-containing protein 19
1ut7_B6e-49516017171NO APICAL MERISTEM PROTEIN
1ut7_A6e-49516017171NO APICAL MERISTEM PROTEIN
1ut4_B6e-49516017171NO APICAL MERISTEM PROTEIN
1ut4_A6e-49516017171NO APICAL MERISTEM PROTEIN
3ulx_A6e-49215412168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9199620.0KJ919962.1 Eriobotrya japonica NAC1 transcription factor (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008237270.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9C8W91e-119NAC30_ARATH; NAC domain-containing protein 30
TrEMBLM5X9M90.0M5X9M9_PRUPE; Uncharacterized protein
STRINGVIT_18s0072g01060.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-102vascular related NAC-domain protein 7